PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000217009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NF-YB
Protein Properties Length: 234aa    MW: 23898.5 Da    PI: 9.6865
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000217009genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB150.53.3e-4759135278
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfed 78 
                    reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe+
  MDP0000217009  59 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEE 135
                    89*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.17E-3238134IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.3E-4453140IPR009072Histone-fold
PfamPF008089.2E-2864128IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.1E-1292110No hitNo description
PROSITE patternPS00685095111IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.1E-12111129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MRYYTARSNG XQRLSVSLSL XPLAPTTKPS ETAGMADSDN DSGGPNDRSQ AQSGELSARE  60
QDRFLPIANV SRIMKKALPA NAKISKDAKE TVQECVSEFI SFVTGEASDK CQREKRKTIN  120
GDDLLWAMTT LGFEEARRAL WGGGGGREKD SSSGGGGAAS GGGGGGGISS GISGGGYNGG  180
YGGMVMMGHH NHHQGHVRGS GGGYQQNHMA MGGGGGRKSG GSSGXGNGGA SVVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B8e-4159140283Transcription factor HapC (Eurofung)
4g92_B8e-4159140283Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.144136e-93bud| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7876639e-83KC787663.1 Brassica napus transcription factor subunit NF-YB3B (NF-YB3B) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008357961.11e-85PREDICTED: LOW QUALITY PROTEIN: nuclear transcription factor Y subunit B-3-like
TrEMBLD7UAG56e-64D7UAG5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t012e-63(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-58nuclear factor Y, subunit B3